Loading...
Statistics
Advertisement

Shady Attia - Selling Christchurch Real Estate
www.shadyattia.com/
Shady Attia - Selling Christchurch Real Estate: Licensed Real Estate Professional operating throughout Christchurch

Shadyattia.com

Domain is redirected to: Shadyattia.co.nz
Advertisement
Conversion Technology Metas Server
Shadyattia.com is hosted in New Zealand / Wellington . Shadyattia.com uses HTTPS protocol. Number of used technologies: 4. First technologies: Html, Html5, Iframe, Number of used javascripts: 28. First javascripts: Get.js?f=bower_...builder.js, Number of used analytics tools: 0. Its server type is: nginx/1.10.1.

Technologies in use by Shadyattia.com

Technology

Number of occurences: 4
  • Html
  • Html5
  • Iframe
  • Php

Advertisement

Javascripts

Number of occurences: 28
  • get.js?f=bower_components%2Fjquery%2Fdist%2Fjquery.js%7Cbower_components%2Funderscore%2Funderscore.js%7Cbower_components%2Funderscore.string%2Fdist%2Funderscore.string.js%7Cbower_components%2Fbackbone%2Fbackbone.js%7Cbower_components%2Fplaceholders%2Flib%2Futils.js%7Cbower_components%2Fplaceholders%2Flib%2Fmain.js%7Cbower_components%2Fmustache%2Fmustache.js%7Ccommon%2Fjs%2Futils.js%7Ccommon%2Fjs%2Fjquery.metadata.js%7Cjs%2FClientStats.js%7Cclient%2Fjs%2Fstandard.js%7Ccommon%2Fjs%2FSection_Form.js%7Cjs%2FModel.js%7Cjs%2FCollection.js%7Cjs%2Fmodels%2FTemplate2_Sector__Site_Viewport.js%7Cjs%2Fmodels%2FSite_Viewport.js%7Ccommon%2Fjs%2FalphanumSort.js%7Ccommon%2Fjs%2FCommerce2.Product.js%7Ccommon%2Fjs%2FCommerce2.Section.js%7Ccommon%2Fjs%2Fjquery.cycle.lite.js%7Cjs%2Fenv-common%2F%2A.js%7Cjs%2Fenv-client%2F%2A.js%7Ccommon%2Fjs%2Fform-utils.js%7Ccommon%2Fjs%2Ffacebox.js%7Ccommon%2Fjs%2Fjquery.cors.js%7Ccommon%2Fjs%2Fnav.js%7Cclient%2Fjs%2Fbuilder.js

Server Type

  • nginx/1.10.1

Powered by

  • PHP/7.0.7-4+deb.sury.org~xenial+1

Conversion rate optimization
visitors Clickable call number Founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Shadyattia.com

SSL certificate

    • name: /CN=shadyattia.com
    • subject:
      • CN: shadyattia.com
    • hash: 085527ba
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 323006455304684859049211546697429842677358
    • validFrom: 160625141300Z
    • validTo: 160923141300Z
    • validFrom_time_t: 1466863980
    • validTo_time_t: 1474639980
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: BF:B3:1D:96:4B:79:E7:48:E2:F0:B1:55:68:02:C3:92:7A:C6:7F:AD
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:shadyattia.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Shadyattia.com

Number of occurences: 5
  • Name: viewport
    Content: width=device-width, initial-scale=1.0, maximum-scale=2.0
  • Name: keywords
    Content: Airport taxi Wellington, quality taxi airport transfers
  • Name: description
    Content: Shady Attia - Selling Christchurch Real Estate: Licensed Real Estate Professional operating throughout Christchurch
  • Name: ROBOTS
    Content: NOODP,NOYDIR
  • Name: SKYPE_TOOLBAR
    Content: SKYPE_TOOLBAR_PARSER_COMPATIBLE

Server / Hosting

  • IP: 202.160.51.106
  • Latitude: -41.28
  • Longitude: 174.78
  • Country: New Zealand
  • City: Wellington

Rname

  • ns71.domaincontrol.com
  • ns72.domaincontrol.com
  • mailstore1.secureserver.net
  • smtp.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.10.1 Date: Wed, 29 Jun 2016 00:26:49 GMT Content-Type: text/html; charset=UTF-8 X-Powered-By: PHP/7.0.7-4+deb.sury.org~xenial+1 Cache-Control: no-store Access-Control-Allow-Origin: * Location: https://www.shadyattia.co.nz/ Vary: Accept-Encoding X-Varnish: 112137580 Age: 0 X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 varnish-v4, 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Date: Wed, 29 Jun 2016 00:26:51 GMT Connection: keep-alive Server: h2o/2.0.0 content-type: text/html; charset=UTF-8 x-powered-by: PHP/7.0.7-4+deb.sury.org~xenial+1 cache-control: no-store access-control-allow-origin: * strict-transport-security: max-age=15552000; x-varnish: 111579772 age: 0 via: 1.1 varnish-v4 accept-ranges: bytes

DNS

host: shadyattia.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 202.160.51.106
host: shadyattia.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns71.domaincontrol.com
host: shadyattia.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns72.domaincontrol.com
host: shadyattia.com
  1. class: IN
  2. ttl: 600
  3. type: SOA
  4. mname: ns71.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016042800
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: shadyattia.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net
host: shadyattia.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hadyattia.com, www.sehadyattia.com, www.ehadyattia.com, www.swhadyattia.com, www.whadyattia.com, www.sdhadyattia.com, www.dhadyattia.com, www.sxhadyattia.com, www.xhadyattia.com, www.sfhadyattia.com, www.fhadyattia.com, www.sghadyattia.com, www.ghadyattia.com, www.sthadyattia.com, www.thadyattia.com, www.sadyattia.com, www.sheadyattia.com, www.seadyattia.com, www.shdadyattia.com, www.sdadyattia.com, www.shcadyattia.com, www.scadyattia.com, www.shuadyattia.com, www.suadyattia.com, www.shjadyattia.com, www.sjadyattia.com, www.shadyattia.com, www.sadyattia.com, www.shbadyattia.com, www.sbadyattia.com, www.shgadyattia.com, www.sgadyattia.com, www.shdyattia.com, www.shaodyattia.com, www.shodyattia.com, www.shapdyattia.com, www.shpdyattia.com, www.sha9dyattia.com, www.sh9dyattia.com, www.shadyattia.com, www.shdyattia.com, www.shaidyattia.com, www.shidyattia.com, www.shaudyattia.com, www.shudyattia.com, www.shayattia.com, www.shadtyattia.com, www.shatyattia.com, www.shadgyattia.com, www.shagyattia.com, www.shadbyattia.com, www.shabyattia.com, www.shadxyattia.com, www.shaxyattia.com, www.shadsyattia.com, www.shasyattia.com, www.shadfyattia.com, www.shafyattia.com, www.shadvyattia.com, www.shavyattia.com, www.shadyyattia.com, www.shayyattia.com, www.shadzyattia.com, www.shazyattia.com, www.shadayattia.com, www.shaayattia.com, www.shadeyattia.com, www.shaeyattia.com, www.shadryattia.com, www.sharyattia.com, www.shadattia.com, www.shadyzattia.com, www.shadzattia.com, www.shadyaattia.com, www.shadaattia.com, www.shadysattia.com, www.shadsattia.com, www.shadydattia.com, www.shaddattia.com, www.shadyattia.com, www.shadattia.com, www.shadycattia.com, www.shadcattia.com, www.shady attia.com, www.shad attia.com, www.shadyttia.com, www.shadyaottia.com, www.shadyottia.com, www.shadyapttia.com, www.shadypttia.com, www.shadya9ttia.com, www.shady9ttia.com, www.shadyattia.com, www.shadyttia.com, www.shadyaittia.com, www.shadyittia.com, www.shadyauttia.com, www.shadyuttia.com, www.shadyatia.com, www.shadyatqtia.com, www.shadyaqtia.com, www.shadyatatia.com, www.shadyaatia.com, www.shadyat tia.com, www.shadya tia.com, www.shadyatwtia.com, www.shadyawtia.com, www.shadyatetia.com, www.shadyaetia.com, www.shadyatztia.com, www.shadyaztia.com, www.shadyatxtia.com, www.shadyaxtia.com, www.shadyatctia.com, www.shadyactia.com, www.shadyatia.com, www.shadyattqia.com, www.shadyatqia.com, www.shadyattaia.com, www.shadyataia.com, www.shadyatt ia.com, www.shadyat ia.com, www.shadyattwia.com, www.shadyatwia.com, www.shadyatteia.com, www.shadyateia.com, www.shadyattzia.com, www.shadyatzia.com, www.shadyattxia.com, www.shadyatxia.com, www.shadyattcia.com, www.shadyatcia.com, www.shadyatta.com, www.shadyattira.com, www.shadyattra.com, www.shadyattifa.com, www.shadyattfa.com, www.shadyattiva.com, www.shadyattva.com, www.shadyattika.com, www.shadyattka.com, www.shadyatti,a.com, www.shadyatt,a.com, www.shadyattiba.com, www.shadyattba.com, www.shadyattiga.com, www.shadyattga.com, www.shadyattita.com, www.shadyattta.com, www.shadyattiya.com, www.shadyattya.com, www.shadyattiua.com, www.shadyattua.com, www.shadyattija.com, www.shadyattja.com, www.shadyattima.com, www.shadyattma.com, www.shadyattina.com, www.shadyattna.com, www.shadyatti.com, www.shadyattiao.com, www.shadyattio.com, www.shadyattiap.com, www.shadyattip.com, www.shadyattia9.com, www.shadyatti9.com, www.shadyattia.com, www.shadyatti.com, www.shadyattiai.com, www.shadyattii.com, www.shadyattiau.com, www.shadyattiu.com,

Other websites we recently analyzed

  1. numeric auto controls pvt. ltd. - authorized Distributors of TECO, AZBIL GROUP, LIMEWARE in Gujarat, India
    India - 115.112.176.58
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 4
  2. OPF S.A.
    elementy aktywne i bierne linii światłowodowych, złącza światłowodowe, wzmacniacze optyczne, dzielniki mocy optycznej, tłumik, systemy transmisyjne; budowa linii telekomunikacyjnych dalekosiężnych i miejscowych, sieci komputerowych, światłowodowych
    Poland - 212.182.89.166
    Server software: Apache
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 6
  3. estousolteiro.com
    San Diego (United States) - 216.104.165.64
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html, Html5, Javascript
    Number of meta tags: 5
  4. به وب سایت ابراهیم وحید زاده خوش آمدید
    به وب سایت ابراهیم وحید زاده خوش آمدید
    Phoenix (United States) - 64.62.132.7
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 3
  5. cherrybeard.com is almost here!
    The owner of this domain has not yet uploaded their website.
    Brea (United States) - 67.205.11.203
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  6. Berufsverband Tiergestützte Therapie, Pädagogik u. Fördermaßnahmen
    Homepage des Berufverbandes tiergestuetzte Paedagogik, Therapie und Foerdermaßnahmen. Informationen zum Thema tiergestuetzte Arbeit aus Forschung und Praxis.
    Germany - 217.160.233.198
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 4
  7. gtib.cn.com
    China - 103.232.215.150
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  8. medicalmalpracticelawyerpennsylvania.com
    Houston (United States) - 108.167.131.22
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  9. EQ Logik - Sönke Wulff
    Germany - 213.203.239.230
    Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
    Technology: Html
    Number of meta tags: 1
  10. Fasching-Karneval-Shop
    Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
    Germany - 62.104.45.105
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 11
    Number of meta tags: 5

Check Other Websites